Recombinant Human AFF1

Cat.No. : AFF1-26446TH
Product Overview : Recombinant fragment of Human AF4 protein with an N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
Sequence Similarities : Belongs to the AF4 family.
Gene Name AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ]
Official Symbol AFF1
Synonyms AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2 , PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4;
Gene ID 4299
mRNA Refseq NM_001166693
Protein Refseq NP_001160165
MIM 159557
Uniprot ID P51825
Chromosome Location 4q21.3
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AFF1 Products

Required fields are marked with *

My Review for All AFF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon