Recombinant Human AFF1

• Cat.No.: AFF1-26446TH
• Product Overview: Recombinant fragment of Human AF4 protein with an N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
• Sequence Similarities: Belongs to the AF4 family.

Gene Information

• Gene Name: AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ]
• Official Symbol: AFF1
• Synonyms: AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2 , PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4
• Gene ID: 4299
• mRNA Refseq: NM_001166693
• Protein Refseq: NP_001160165
• MIM: 159557
• Uniprot ID: P51825
• Chromosome Location: 4q21.3
• Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: sequence-specific DNA binding transcription factor activity