"AFF1" Related Products

Expand

Recombinant Human AFF1

Cat.No.: AFF1-26446TH
Product Overview: Recombinant fragment of Human AF4 protein with an N terminal proprietary tag; Predicted MW 36.63 kDa.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
Sequence Similarities: Belongs to the AF4 family.
Gene Name: AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ]
Official Symbol: AFF1
Synonyms: AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2 , PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4;
Gene ID: 4299
mRNA Refseq: NM_001166693
Protein Refseq: NP_001160165
MIM: 159557
Uniprot ID: P51825
Chromosome Location: 4q21.3
Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.