Recombinant Human AFF1 Protein, GST-tagged
Cat.No. : | AFF1-405H |
Product Overview : | Human AFF1 partial ORF ( NP_005926.1, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the AF4/ lymphoid nuclear protein related to AF4/Fragile X E mental retardation syndrome family of proteins, which have been implicated in childhood lymphoblastic leukemia, Fragile X E site mental retardation, and ataxia. It is the prevalent mixed-lineage leukemia fusion gene associated with spontaneous acute lymphoblastic leukemia. Members of this family have three conserved domains: an N-terminal homology domain, an AF4/ lymphoid nuclear protein related to AF4/Fragile X E mental retardation syndrome domain, and a C-terminal homology domain. The protein functions as a regulator of RNA polymerase II-mediated transcription through elongation and chromatin remodeling functions. Through RNA interference screens, this gene has been shown to promote the expression of CD133, a plasma membrane glycoprotein required for leukemia cell survival. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ] |
Official Symbol | AFF1 |
Synonyms | AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2, PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; protein AF-4; proto-oncogene AF4; pre-B-cell monocytic leukemia partner 1; ALL1-fused gene from chromosome 4 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; PBM1; MLLT2; MGC134969; |
Gene ID | 4299 |
mRNA Refseq | NM_001166693 |
Protein Refseq | NP_001160165 |
MIM | 159557 |
UniProt ID | P51825 |
◆ Recombinant Proteins | ||
AFF1-26446TH | Recombinant Human AFF1 | +Inquiry |
Aff1-3230M | Recombinant Mouse Aff1, His-tagged | +Inquiry |
AFF1-405H | Recombinant Human AFF1 Protein, GST-tagged | +Inquiry |
AFF1-1732H | Recombinant Human AFF1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFF1 Products
Required fields are marked with *
My Review for All AFF1 Products
Required fields are marked with *
0
Inquiry Basket