Recombinant Human AFF1 Protein, GST-tagged

Cat.No. : AFF1-405H
Product Overview : Human AFF1 partial ORF ( NP_005926.1, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the AF4/ lymphoid nuclear protein related to AF4/Fragile X E mental retardation syndrome family of proteins, which have been implicated in childhood lymphoblastic leukemia, Fragile X E site mental retardation, and ataxia. It is the prevalent mixed-lineage leukemia fusion gene associated with spontaneous acute lymphoblastic leukemia. Members of this family have three conserved domains: an N-terminal homology domain, an AF4/ lymphoid nuclear protein related to AF4/Fragile X E mental retardation syndrome domain, and a C-terminal homology domain. The protein functions as a regulator of RNA polymerase II-mediated transcription through elongation and chromatin remodeling functions. Through RNA interference screens, this gene has been shown to promote the expression of CD133, a plasma membrane glycoprotein required for leukemia cell survival. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 36.74 kDa
AA Sequence : LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ]
Official Symbol AFF1
Synonyms AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2, PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; protein AF-4; proto-oncogene AF4; pre-B-cell monocytic leukemia partner 1; ALL1-fused gene from chromosome 4 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; PBM1; MLLT2; MGC134969;
Gene ID 4299
mRNA Refseq NM_001166693
Protein Refseq NP_001160165
MIM 159557
UniProt ID P51825

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AFF1 Products

Required fields are marked with *

My Review for All AFF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon