Recombinant Human AKAP9, His-tagged

• Cat.No.: AKAP9-26527TH
• Product Overview: Recombinant fragment, corresponding to amino acids 3496-3773 of Human AKAP9 with N terminal His tag; 278 amino acids, 32kDa.

Specification

• Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Widely expressed. Isoform 4 is highly expressed in skeletal muscle and in pancreas.
• Form: Lyophilised:Reconstitute with 82 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GGTGCNHELEMIRQKLQCVASKLQVLPQKASERLQFETAD DEDFIWVQENIDEIILQLQKLTGQQGEEPSLVSPSTSC GSLTERLLRQNAELTGHISQLTEEKNDLRNMVMKLEEQIR WYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWNREK LTLQKSLKRAEAEVYKLKAELRNDSLLQTLSPDSEHVT LKRIYGKYLRAESFRKALIYQKKYLLLLLGGFQECEDATL ALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAI SRMKFL

Gene Information

• Gene Name: AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 [ Homo sapiens ]
• Official Symbol: AKAP9
• Synonyms: AKAP9; A kinase (PRKA) anchor protein (yotiao) 9; A-kinase anchor protein 9; A kinase anchor protein; 350kDa; A kinase anchoring protein 450; AKAP9 BRAF fusion protein; AKAP120 like protein; AKAP350; AKAP450; centrosome and golgi localized protein; CG NA
• Gene ID: 10142
• mRNA Refseq: NM_005751
• Protein Refseq: NP_005742
• MIM: 604001
• Uniprot ID: Q99996
• Chromosome Location: 7q21-q22
• Pathway: Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem
• Function: kinase activity; protein binding; receptor binding