Recombinant Human AKAP9 Protein, GST-tagged

Cat.No. : AKAP9-405H
Product Overview : Human AKAP9 partial ORF ( NP_671700, 3812 a.a. - 3911 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. [provided by RefSeq, Aug 2008]
Molecular Mass : 36.74 kDa
AA Sequence : EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 [ Homo sapiens ]
Official Symbol AKAP9
Synonyms AKAP9; A kinase (PRKA) anchor protein (yotiao) 9; A-kinase anchor protein 9; A kinase anchor protein; 350kDa; A kinase anchoring protein 450; AKAP9 BRAF fusion protein; AKAP120 like protein; AKAP350; AKAP450; centrosome and golgi localized protein; CG NAP; HYPERION; KIAA0803; kinase N associated protein; MU RMS 40.16A; PPP1R45; PRKA9; protein kinase A anchoring protein 9; protein phosphatase 1; regulatory subunit 45; YOTIAO; protein yotiao; protein hyperion; AKAP 120-like protein; AKAP9-BRAF fusion protein; kinase N-associated protein; A-kinase anchor protein 350 kDa; A-kinase anchor protein 450 kDa; protein phosphatase 1, regulatory subunit 45; centrosome- and Golgi-localized PKN-associated protein; AKAP-9; CG-NAP; MU-RMS-40.16A;
Gene ID 10142
mRNA Refseq NM_005751
Protein Refseq NP_005742
MIM 604001
UniProt ID Q99996

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP9 Products

Required fields are marked with *

My Review for All AKAP9 Products

Required fields are marked with *

0
cart-icon
0
compare icon