"ALDH1A1" Related Products

Expand
Expand
Expand

Recombinant Human ALDH1A1, His-tagged

Cat.No.: ALDH1A1-27036TH
Product Overview: Recombinant fragment, corresponding to amino acids 255-501 of Human ALDH1A1 with an N terminal His tag. observed mol wt: 29 kDa;
Description: The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHG VFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYIL GNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLEC GGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMK FKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQ AGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEY TEVKTVTVKISQKNS
Sequence Similarities: Belongs to the aldehyde dehydrogenase family.
Gene Name: ALDH1A1 aldehyde dehydrogenase 1 family, member A1 [ Homo sapiens ]
Official Symbol: ALDH1A1
Synonyms: ALDH1A1; aldehyde dehydrogenase 1 family, member A1; ALDH1, PUMB1; retinal dehydrogenase 1; RALDH1; retinaldehyde dehydrogenase 1;
Gene ID: 216
mRNA Refseq: NM_000689
Protein Refseq: NP_000680
MIM: 100640
Uniprot ID: P00352
Chromosome Location: 9q21.13
Pathway: Biological oxidations, organism-specific biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: Ras GTPase activator activity; aldehyde dehydrogenase (NAD) activity; androgen binding; oxidoreductase activity; retinal dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.