Recombinant Human ALDH1A1 protein, His-tagged

Cat.No. : ALDH1A1-3443H
Product Overview : Recombinant Human ALDH1A1 protein(153-501 aa), fused to His tag, was expressed in E. coli.
Availability July 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 153-501 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ALDH1A1 aldehyde dehydrogenase 1 family, member A1 [ Homo sapiens ]
Official Symbol ALDH1A1
Synonyms ALDH1A1; aldehyde dehydrogenase 1 family, member A1; ALDH1, PUMB1; retinal dehydrogenase 1; RALDH1; retinaldehyde dehydrogenase 1; ALHDII; RALDH 1; ALDH class 1; acetaldehyde dehydrogenase 1; aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase, liver cytosolic; ALDC; ALDH1; PUMB1; ALDH11; ALDH-E1; MGC2318;
Gene ID 216
mRNA Refseq NM_000689
Protein Refseq NP_000680
MIM 100640
UniProt ID P00352

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALDH1A1 Products

Required fields are marked with *

My Review for All ALDH1A1 Products

Required fields are marked with *

0
cart-icon