"ALDOA" Related Products

Expand
Expand

Recombinant Human ALDOA

Cat.No.: ALDOA-26497TH
Product Overview: Recombinant full length Human Aldolase expressed in Saccharomyces cerevisiae; 364 amino acids, MWt 39.4 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGE HTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMV TPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLS GGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASA LKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY
Gene Name: ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ]
Official Symbol: ALDOA
Synonyms: ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A;
Gene ID: 226
mRNA Refseq: NM_000034
Protein Refseq: NP_000025
MIM: 103850
Uniprot ID: P04075
Chromosome Location: 16p11.2
Pathway: Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem;
Function: actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.