Recombinant Human ANP32A

PRODUCTS

Home / Products / Antibody / Recombinant Human ANP32A

Recombinant Human ANP32A

ANP32A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ANP32A-30006TH
Product Overview : Recombinant full length Human PHAP1 expressed in Saccharomyces cerevisiae; 249 amino acids, MWt 28.6 kDa. Protein is tagged with 26 kDa proprietary tag.
Tissue specificity : Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus cal
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDE FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSG GLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAP DSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDE EEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERG QKRKREPEDEGEDDD
Sequence Similarities : Belongs to the ANP32 family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.
Gene Name : ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ]
Official Symbol : ANP32A
Synonyms : ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32;
Gene ID : 8125
mRNA Refseq : NM_006305
Protein Refseq : NP_006296
MIM : 600832
Uniprot ID : P39687
Chromosome Location : 15q23
Pathway : Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Stabilization of mRNA by HuR, organism-specific biosystem;
Function : protein binding;

Online Inquiry


  •  
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information
  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.