Recombinant Human ANP32C
Cat.No. : | ANP32C-27323TH |
Product Overview : | Recombinant Full Length Human ANP32C produced in Saccharomyces cerevisiae; 234 amino acids, MWt 26.7 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Description : | Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDE FEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEV LAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDL FNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDI EDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEG EEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQK RK |
Gene Name : | ANP32C acidic (leucine-rich) nuclear phosphoprotein 32 family, member C [ Homo sapiens ] |
Official Symbol : | ANP32C |
Synonyms : | ANP32C; acidic (leucine-rich) nuclear phosphoprotein 32 family, member C; acidic leucine-rich nuclear phosphoprotein 32 family member C; PP32R1; |
Gene ID : | 23520 |
mRNA Refseq : | NM_012403 |
Protein Refseq : | NP_036535 |
MIM : | 606877 |
Uniprot ID : | O43423 |
Chromosome Location : | 4q32.3 |
Products Types
◆ Recombinant Protein | ||
ANP32C-2160H | Recombinant Human ANP32C Protein, His-tagged | +Inquiry |
ANP32C-619H | Recombinant Human ANP32C protein | +Inquiry |
◆ Lysates | ||
ANP32C-8841HCL | Recombinant Human ANP32C 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket