| Species : |
Human |
| Tag : |
Non |
| Description : |
Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. |
| Form : |
Liquid |
| Purity : |
>90% by SDS-PAGE |
| Storage buffer : |
Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDE FEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEV LAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDL FNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDI EDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEG EEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQK RK |
| Full Length : |
Full L. |