Recombinant Human ANP32C protein

Cat.No. : ANP32C-619H
Product Overview : Human ANP32C (O43423) full-length recombinant protein expressed in yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : Non
Description : Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. [provided by RefSeq, Jul 2008]
Form : Liquid
Molecular Mass : 26.733 kDa
AA Sequence : MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK
Purity : 90%
Applications : SDS-PAGE
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene Name ANP32C acidic (leucine-rich) nuclear phosphoprotein 32 family, member C [ Homo sapiens ]
Official Symbol ANP32C
Synonyms ANP32C; acidic (leucine-rich) nuclear phosphoprotein 32 family, member C; acidic leucine-rich nuclear phosphoprotein 32 family member C; PP32R1; pp32 related 1; tumorigenic protein pp32r1; phosphoprotein 32-related protein 1;
Gene ID 23520
mRNA Refseq NM_012403
Protein Refseq NP_036535
MIM 606877
UniProt ID O43423

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANP32C Products

Required fields are marked with *

My Review for All ANP32C Products

Required fields are marked with *

0
cart-icon
0
compare icon