Recombinant Human ANP32C protein
Cat.No. : | ANP32C-619H |
Product Overview : | Human ANP32C (O43423) full-length recombinant protein expressed in yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Description : | Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 26.733 kDa |
AA Sequence : | MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK |
Purity : | 90% |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
Gene Name | ANP32C acidic (leucine-rich) nuclear phosphoprotein 32 family, member C [ Homo sapiens ] |
Official Symbol | ANP32C |
Synonyms | ANP32C; acidic (leucine-rich) nuclear phosphoprotein 32 family, member C; acidic leucine-rich nuclear phosphoprotein 32 family member C; PP32R1; pp32 related 1; tumorigenic protein pp32r1; phosphoprotein 32-related protein 1; |
Gene ID | 23520 |
mRNA Refseq | NM_012403 |
Protein Refseq | NP_036535 |
MIM | 606877 |
UniProt ID | O43423 |
◆ Recombinant Proteins | ||
ANP32C-27323TH | Recombinant Human ANP32C | +Inquiry |
ANP32C-2160H | Recombinant Human ANP32C Protein, His-tagged | +Inquiry |
ANP32C-619H | Recombinant Human ANP32C protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANP32C-8841HCL | Recombinant Human ANP32C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANP32C Products
Required fields are marked with *
My Review for All ANP32C Products
Required fields are marked with *
0
Inquiry Basket