"AP2A1" Related Products

Expand

Recombinant Human AP2A1, His-tagged

Cat.No.: AP2A1-27357TH
Product Overview: Recombinant fragment, corresponding to amino acids 734-950 of Human AP2 alpha isoform B, with a N terminal His tag; predicted MWt 25kDa:
Description: This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined.
Conjugation: HIS
Source: E. coli
Tissue specificity: Isoform A expressed in forebrain, skeletal muscle, spinal cord, cerebellum, salivary gland, heart and colon. Isoform B is widely expressed in tissues and also in breast cancer and in prostate carcinoma cells.
Form: Lyophilised:Reconstitution with 45 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTV VHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRD FLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMA AQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGF GSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNA QAQMYRLTLRTSKEPVSRHLCEL
Sequence Similarities: Belongs to the adaptor complexes large subunit family.
Gene Name: AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ]
Official Symbol: AP2A1
Synonyms: AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1;
Gene ID: 160
mRNA Refseq: NM_014203
Protein Refseq: NP_055018
MIM: 601026
Uniprot ID: O95782
Chromosome Location: 19q13.3
Pathway: Arf1 pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem;
Function: protein C-terminus binding; protein binding; protein transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.