"APOBEC1" Related Products

Recombinant Human APOBEC1

Cat.No.: APOBEC1-26872TH
Product Overview: Recombinant fragment of Human APOBEC1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed exclusively in the small intestine.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR
Sequence Similarities: Belongs to the cytidine and deoxycytidylate deaminase family.
Gene Name: APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ]
Official Symbol: APOBEC1
Synonyms: APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR;
Gene ID: 339
mRNA Refseq: NM_001644
Protein Refseq: NP_001635
MIM: 600130
Uniprot ID: P41238
Chromosome Location: 12p13.1
Pathway: Formation of the Editosome, organism-specific biosystem; mRNA Editing, organism-specific biosystem; mRNA Editing: C to U Conversion, organism-specific biosystem; mRNA Processing, organism-specific biosystem;
Function: AU-rich element binding; RNA binding; cytidine deaminase activity; hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.