Recombinant Human APOBEC1

PRODUCTS

Home / Products / Antibody / Recombinant Human APOBEC1

Recombinant Human APOBEC1

APOBEC1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : APOBEC1-26872TH
Product Overview : Recombinant fragment of Human APOBEC1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description : This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed exclusively in the small intestine.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR
Sequence Similarities : Belongs to the cytidine and deoxycytidylate deaminase family.
Gene Name : APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ]
Official Symbol : APOBEC1
Synonyms : APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR;
Gene ID : 339
mRNA Refseq : NM_001644
Protein Refseq : NP_001635
MIM : 600130
Uniprot ID : P41238
Chromosome Location : 12p13.1
Pathway : Formation of the Editosome, organism-specific biosystem; mRNA Editing, organism-specific biosystem; mRNA Editing: C to U Conversion, organism-specific biosystem; mRNA Processing, organism-specific biosystem;
Function : AU-rich element binding; RNA binding; cytidine deaminase activity; hydrolase activity; metal ion binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.