Recombinant Human APOBEC1
| Cat.No. : | APOBEC1-26872TH |
| Product Overview : | Recombinant fragment of Human APOBEC1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed exclusively in the small intestine. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR |
| Sequence Similarities : | Belongs to the cytidine and deoxycytidylate deaminase family. |
| Gene Name | APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ] |
| Official Symbol | APOBEC1 |
| Synonyms | APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR; |
| Gene ID | 339 |
| mRNA Refseq | NM_001644 |
| Protein Refseq | NP_001635 |
| MIM | 600130 |
| Uniprot ID | P41238 |
| Chromosome Location | 12p13.1 |
| Pathway | Formation of the Editosome, organism-specific biosystem; mRNA Editing, organism-specific biosystem; mRNA Editing: C to U Conversion, organism-specific biosystem; mRNA Processing, organism-specific biosystem; |
| Function | AU-rich element binding; RNA binding; cytidine deaminase activity; hydrolase activity; metal ion binding; |
| ◆ Recombinant Proteins | ||
| APOBEC1-377R | Recombinant Rat APOBEC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APOBEC1-721R | Recombinant Rat APOBEC1 Protein | +Inquiry |
| APOBEC1-26872TH | Recombinant Human APOBEC1 | +Inquiry |
| APOBEC1-1785M | Recombinant Mouse APOBEC1 Protein | +Inquiry |
| APOBEC1-695H | Recombinant Human APOBEC1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOBEC1-8786HCL | Recombinant Human APOBEC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC1 Products
Required fields are marked with *
My Review for All APOBEC1 Products
Required fields are marked with *
