Recombinant Human APOBEC1 protein, GST-tagged
Cat.No. : | APOBEC1-695H |
Product Overview : | Human APOBEC1 partial ORF ( NP_001635, 137 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ] |
Official Symbol | APOBEC1 |
Synonyms | APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR; C-> U-editing enzyme APOBEC-1; apolipoprotein B mRNA-editing enzyme 1; apolipoprotein B mRNA editing enzyme complex-1; APOBEC-1; |
Gene ID | 339 |
mRNA Refseq | NM_001644 |
Protein Refseq | NP_001635 |
MIM | 600130 |
UniProt ID | P41238 |
◆ Recombinant Proteins | ||
APOBEC1-377R | Recombinant Rat APOBEC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC1-26872TH | Recombinant Human APOBEC1 | +Inquiry |
APOBEC1-721R | Recombinant Rat APOBEC1 Protein | +Inquiry |
APOBEC1-1785M | Recombinant Mouse APOBEC1 Protein | +Inquiry |
APOBEC1-695H | Recombinant Human APOBEC1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC1-8786HCL | Recombinant Human APOBEC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBEC1 Products
Required fields are marked with *
My Review for All APOBEC1 Products
Required fields are marked with *
0
Inquiry Basket