Recombinant Human APOBEC1 protein, GST-tagged

• Cat.No.: APOBEC1-695H
• Product Overview: Human APOBEC1 partial ORF ( NP_001635, 137 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: SGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 [ Homo sapiens ]
• Official Symbol: APOBEC1
• Synonyms: APOBEC1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1; C->U-editing enzyme APOBEC-1; APOBEC 1; BEDP; CDAR1; HEPR; C-> U-editing enzyme APOBEC-1; apolipoprotein B mRNA-editing enzyme 1; apolipoprotein B mRNA editing enzyme complex-1; APOBEC-1
• Gene ID: 339
• mRNA Refseq: NM_001644
• Protein Refseq: NP_001635
• MIM: 600130
• UniProt ID: P41238