"ARFGAP2" Related Products

Expand

Recombinant Human ARFGAP2, His-tagged

Cat.No.: ARFGAP2-30760TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-226 of Human ZNF289 with N terminal His tag; 226 amino acids, 26kDa.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 68 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASIT YGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLR CMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFT EHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPN TDLLGTSPKASLELKSSIIGKKKPAAAKKGLG
Sequence Similarities: Contains 1 Arf-GAP domain.
Gene Name: ARFGAP2 ADP-ribosylation factor GTPase activating protein 2 [ Homo sapiens ]
Official Symbol: ARFGAP2
Synonyms: ARFGAP2; ADP-ribosylation factor GTPase activating protein 2; zinc finger protein 289, ID1 regulated , ZNF289; ADP-ribosylation factor GTPase-activating protein 2; FLJ14576; IRZ; Zfp289;
Gene ID: 84364
mRNA Refseq: NM_001242832
Protein Refseq: NP_001229761
MIM: 606908
Uniprot ID: Q8N6H7
Chromosome Location: 11p11.2-p11.12
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function: ARF GTPase activator activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.