"ARFGAP2" Related Products

Expand

Recombinant Human ARFGAP2, His-tagged

Cat.No.: ARFGAP2-30760TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-226 of Human ZNF289 with N terminal His tag; 226 amino acids, 26kDa.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 68 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASIT YGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLR CMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFT EHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPN TDLLGTSPKASLELKSSIIGKKKPAAAKKGLG
Sequence Similarities: Contains 1 Arf-GAP domain.
Gene Name: ARFGAP2 ADP-ribosylation factor GTPase activating protein 2 [ Homo sapiens ]
Official Symbol: ARFGAP2
Synonyms: ARFGAP2; ADP-ribosylation factor GTPase activating protein 2; zinc finger protein 289, ID1 regulated , ZNF289; ADP-ribosylation factor GTPase-activating protein 2; FLJ14576; IRZ; Zfp289;
Gene ID: 84364
mRNA Refseq: NM_001242832
Protein Refseq: NP_001229761
MIM: 606908
Uniprot ID: Q8N6H7
Chromosome Location: 11p11.2-p11.12
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function: ARF GTPase activator activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.