"ARFGAP2" Related Products

Expand

Recombinant Human ARFGAP2, His-tagged

Cat.No. : ARFGAP2-30760TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-226 of Human ZNF289 with N terminal His tag; 226 amino acids, 26kDa.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 68 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASIT YGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLR CMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFT EHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPN TDLLGTSPKASLELKSSIIGKKKPAAAKKGLG
Sequence Similarities : Contains 1 Arf-GAP domain.
Gene Name : ARFGAP2 ADP-ribosylation factor GTPase activating protein 2 [ Homo sapiens ]
Official Symbol : ARFGAP2
Synonyms : ARFGAP2; ADP-ribosylation factor GTPase activating protein 2; zinc finger protein 289, ID1 regulated , ZNF289; ADP-ribosylation factor GTPase-activating protein 2; FLJ14576; IRZ; Zfp289;
Gene ID : 84364
mRNA Refseq : NM_001242832
Protein Refseq : NP_001229761
MIM : 606908
Uniprot ID : Q8N6H7
Chromosome Location : 11p11.2-p11.12
Pathway : Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function : ARF GTPase activator activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.