Recombinant Human ARFGAP2, His-tagged
| Cat.No. : | ARFGAP2-30760TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-226 of Human ZNF289 with N terminal His tag; 226 amino acids, 26kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-226 a.a. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 68 μl distilled water. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASIT YGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLR CMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFT EHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPN TDLLGTSPKASLELKSSIIGKKKPAAAKKGLG | 
| Sequence Similarities : | Contains 1 Arf-GAP domain. | 
| Gene Name | ARFGAP2 ADP-ribosylation factor GTPase activating protein 2 [ Homo sapiens ] | 
| Official Symbol | ARFGAP2 | 
| Synonyms | ARFGAP2; ADP-ribosylation factor GTPase activating protein 2; zinc finger protein 289, ID1 regulated , ZNF289; ADP-ribosylation factor GTPase-activating protein 2; FLJ14576; IRZ; Zfp289; | 
| Gene ID | 84364 | 
| mRNA Refseq | NM_001242832 | 
| Protein Refseq | NP_001229761 | 
| MIM | 606908 | 
| Uniprot ID | Q8N6H7 | 
| Chromosome Location | 11p11.2-p11.12 | 
| Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; | 
| Function | ARF GTPase activator activity; metal ion binding; zinc ion binding; | 
| ◆ Recombinant Proteins | ||
| ARFGAP2-3542Z | Recombinant Zebrafish ARFGAP2 | +Inquiry | 
| ARFGAP2-30760TH | Recombinant Human ARFGAP2, His-tagged | +Inquiry | 
| ARFGAP2-9805H | Recombinant Human ARFGAP2, GST-tagged | +Inquiry | 
| ARFGAP2-3269C | Recombinant Chicken ARFGAP2 | +Inquiry | 
| ARFGAP2-410R | Recombinant Rat ARFGAP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ARFGAP2-2003HCL | Recombinant Human ARFGAP2 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFGAP2 Products
Required fields are marked with *
My Review for All ARFGAP2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            