Recombinant Human ARFGAP2, His-tagged
Cat.No. : | ARFGAP2-30760TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-226 of Human ZNF289 with N terminal His tag; 226 amino acids, 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-226 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 68 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASIT YGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLR CMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFT EHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPN TDLLGTSPKASLELKSSIIGKKKPAAAKKGLG |
Sequence Similarities : | Contains 1 Arf-GAP domain. |
Gene Name | ARFGAP2 ADP-ribosylation factor GTPase activating protein 2 [ Homo sapiens ] |
Official Symbol | ARFGAP2 |
Synonyms | ARFGAP2; ADP-ribosylation factor GTPase activating protein 2; zinc finger protein 289, ID1 regulated , ZNF289; ADP-ribosylation factor GTPase-activating protein 2; FLJ14576; IRZ; Zfp289; |
Gene ID | 84364 |
mRNA Refseq | NM_001242832 |
Protein Refseq | NP_001229761 |
MIM | 606908 |
Uniprot ID | Q8N6H7 |
Chromosome Location | 11p11.2-p11.12 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; |
Function | ARF GTPase activator activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ARFGAP2-754R | Recombinant Rat ARFGAP2 Protein | +Inquiry |
ARFGAP2-3542Z | Recombinant Zebrafish ARFGAP2 | +Inquiry |
ARFGAP2-30760TH | Recombinant Human ARFGAP2, His-tagged | +Inquiry |
ARFGAP2-410R | Recombinant Rat ARFGAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFGAP2-9805H | Recombinant Human ARFGAP2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFGAP2-2003HCL | Recombinant Human ARFGAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFGAP2 Products
Required fields are marked with *
My Review for All ARFGAP2 Products
Required fields are marked with *