"ARL3" Related Products

Expand

Recombinant Human ARL3, His-tagged

Cat.No.: ARL3-26179TH
Product Overview: Recombinant full-length Human ARL3 with a N terminal His tag. 206 amino acids with a predicted MWt 23 kDa including tag.
Description: ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
Protein length: 182 amino acids
Conjugation: HIS
Molecular Weight: 23.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
Gene Name: ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
Official Symbol: ARL3
Synonyms: ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3;
Gene ID: 403
mRNA Refseq: NM_004311
Protein Refseq: NP_004302
MIM: 604695
Uniprot ID: P36405
Chromosome Location: 10q23.3
Function: GDP binding; GTP binding; metal ion binding; microtubule binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.