"ARL3" Related Products

Expand

Recombinant Human ARL3, His-tagged

Cat.No. : ARL3-26179TH
Product Overview : Recombinant full-length Human ARL3 with a N terminal His tag. 206 amino acids with a predicted MWt 23 kDa including tag.
Description : ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
Protein length : 182 amino acids
Conjugation : HIS
Molecular Weight : 23.000kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name : ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
Official Symbol : ARL3
Synonyms : ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3;
Gene ID : 403
mRNA Refseq : NM_004311
Protein Refseq : NP_004302
MIM : 604695
Uniprot ID : P36405
Chromosome Location : 10q23.3
Function : GDP binding; GTP binding; metal ion binding; microtubule binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.