Recombinant Human ARMC6, His-tagged
Cat.No. : | ARMC6-26183TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 207-476 of Human ARMC6 with N terminal His tag; 270 amino acids, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 207-476 a.a. |
Description : | The function of this genes protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 134 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HGHHTDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQ ENKGLKVLIEATKAFLDNPGILSELCGTLSRLAIRNEF CQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVC EQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHP QKAGVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRGNLAP |
Gene Name | ARMC6 armadillo repeat containing 6 [ Homo sapiens ] |
Official Symbol | ARMC6 |
Synonyms | ARMC6; armadillo repeat containing 6; armadillo repeat-containing protein 6; MGC19595; |
Gene ID | 93436 |
mRNA Refseq | NM_033415 |
Protein Refseq | NP_219483 |
Uniprot ID | Q6NXE6 |
Chromosome Location | 19p13 |
Function | binding; |
◆ Recombinant Proteins | ||
ARMC6-236R | Recombinant Rhesus Macaque ARMC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARMC6-26183TH | Recombinant Human ARMC6, His-tagged | +Inquiry |
ARMC6-829H | Recombinant Human ARMC6 protein, GST-tagged | +Inquiry |
ARMC6-737M | Recombinant Mouse ARMC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Armc6-1718M | Recombinant Mouse Armc6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC6-8701HCL | Recombinant Human ARMC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC6 Products
Required fields are marked with *
My Review for All ARMC6 Products
Required fields are marked with *