"ARMC6" Related Products

Expand

Recombinant Human ARMC6, His-tagged

Cat.No.: ARMC6-26183TH
Product Overview: Recombinant fragment, corresponding to amino acids 207-476 of Human ARMC6 with N terminal His tag; 270 amino acids, 33kDa.
Description: The function of this genes protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 134 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HGHHTDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQ ENKGLKVLIEATKAFLDNPGILSELCGTLSRLAIRNEF CQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVC EQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHP QKAGVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRGNLAP
Gene Name: ARMC6 armadillo repeat containing 6 [ Homo sapiens ]
Official Symbol: ARMC6
Synonyms: ARMC6; armadillo repeat containing 6; armadillo repeat-containing protein 6; MGC19595;
Gene ID: 93436
mRNA Refseq: NM_033415
Protein Refseq: NP_219483
Uniprot ID: Q6NXE6
Chromosome Location: 19p13
Function: binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.