"ARMC6" Related Products

Expand

Recombinant Human ARMC6, His-tagged

Cat.No.: ARMC6-26183TH
Product Overview: Recombinant fragment, corresponding to amino acids 207-476 of Human ARMC6 with N terminal His tag; 270 amino acids, 33kDa.
Description: The function of this genes protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 134 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HGHHTDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQ ENKGLKVLIEATKAFLDNPGILSELCGTLSRLAIRNEF CQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVC EQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHP QKAGVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRGNLAP
Gene Name: ARMC6 armadillo repeat containing 6 [ Homo sapiens ]
Official Symbol: ARMC6
Synonyms: ARMC6; armadillo repeat containing 6; armadillo repeat-containing protein 6; MGC19595;
Gene ID: 93436
mRNA Refseq: NM_033415
Protein Refseq: NP_219483
Uniprot ID: Q6NXE6
Chromosome Location: 19p13
Function: binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.