Recombinant Human ARR3

PRODUCTS

Home / Products / Antibody / Recombinant Human ARR3

Recombinant Human ARR3

ARR3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ARR3-26077TH
Product Overview : Recombinant full length Human Arrestin C isoform 2 with N terminal proprietary tag; Predicted MWt 65.56 kDa.
Description : Arrestin-C also known as retinal cone arrestin-3 is a protein that in humans is encoded by the ARR3 gene.
Protein length : 359 amino acids
Molecular Weight : 65.560kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Inner and outer segments, and the inner plexiform regions of the retina.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVD PEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTL QVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDY VRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWM DREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKV RVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR
Sequence Similarities : Belongs to the arrestin family.
Gene Name : ARR3 arrestin 3, retinal (X-arrestin) [ Homo sapiens ]
Official Symbol : ARR3
Synonyms : ARR3; arrestin 3, retinal (X-arrestin); arrestin-C; arrestin 4; ARRX;
Gene ID : 407
mRNA Refseq : NM_004312
Protein Refseq : NP_004303
MIM : 301770
Uniprot ID : P36575
Chromosome Location : Xq
Pathway : CXCR4-mediated signaling events, organism-specific biosystem; Thromboxane A2 receptor signaling, organism-specific biosystem; Visual signal transduction: Cones, organism-specific biosystem;
Function : opsin binding; phosphoprotein binding; protein binding; protein domain specific binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.