"ARR3" Related Products

Expand

Recombinant Human ARR3

Cat.No.: ARR3-26077TH
Product Overview: Recombinant full length Human Arrestin C isoform 2 with N terminal proprietary tag; Predicted MWt 65.56 kDa.
Description: Arrestin-C also known as retinal cone arrestin-3 is a protein that in humans is encoded by the ARR3 gene.
Protein length: 359 amino acids
Molecular Weight: 65.560kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Inner and outer segments, and the inner plexiform regions of the retina.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVD PEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTL QVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDY VRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWM DREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKV RVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR
Sequence Similarities: Belongs to the arrestin family.
Gene Name: ARR3 arrestin 3, retinal (X-arrestin) [ Homo sapiens ]
Official Symbol: ARR3
Synonyms: ARR3; arrestin 3, retinal (X-arrestin); arrestin-C; arrestin 4; ARRX;
Gene ID: 407
mRNA Refseq: NM_004312
Protein Refseq: NP_004303
MIM: 301770
Uniprot ID: P36575
Chromosome Location: Xq
Pathway: CXCR4-mediated signaling events, organism-specific biosystem; Thromboxane A2 receptor signaling, organism-specific biosystem; Visual signal transduction: Cones, organism-specific biosystem;
Function: opsin binding; phosphoprotein binding; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.