Recombinant Human ARSB

Cat.No. : ARSB-26104TH
Product Overview : Recombinant fragment of Human ARSB with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Sequence Similarities : Belongs to the sulfatase family.
Gene Name ARSB arylsulfatase B [ Homo sapiens ]
Official Symbol ARSB
Synonyms ARSB; arylsulfatase B;
Gene ID 411
mRNA Refseq NM_000046
Protein Refseq NP_000037
MIM 611542
Uniprot ID P15848
Chromosome Location 5p11-q13
Pathway Chondroitin sulfate degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem;
Function N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity; catalytic activity; hydrolase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARSB Products

Required fields are marked with *

My Review for All ARSB Products

Required fields are marked with *

0
cart-icon
0
compare icon