Recombinant Human ATF2

• Cat.No.: ATF2-26187TH
• Product Overview: Recombinant fragment: MSDDKPFLCT APGCGQRFTN EDHLAVHKHK HEMTLKFGPA RNDSVIVADQ TPTPTRFLKN CEEVGLFNEL ASPFENEF, corresponding to amino acids 19-96 of Human ATF2 with an N-terminal proprietary tag, MWt 34.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 19-96 a.a.
• Description: This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. Additional transcript variants have been identified but their biological validity has not been determined.
• Tissue specificity: Abundant expression seen in the brain.
• Form: Lyophilised
• Storage buffer: Preservative: NoneConstituents: 50% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8.0
• Storage: Store at -80°C
• Sequences of amino acids: MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEF
• Sequence Similarities: Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain.Contains 1 C2H2-type zinc finger.

Gene Information

• Gene Name: ATF2 activating transcription factor 2 [ Homo sapiens ]
• Official Symbol: ATF2
• Synonyms: ATF2; activating transcription factor 2; cAMP responsive element binding protein 2 , CREB2; cyclic AMP-dependent transcription factor ATF-2; CRE BP1; HB16; TREB7
• Gene ID: 1386
• mRNA Refseq: NM_001880
• Protein Refseq: NP_001871
• MIM: 123811
• Uniprot ID: P15336
• Chromosome Location: 2q32
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; chromatin binding; metal ion binding; protein binding