Recombinant Human ATF2
Cat.No. : | ATF2-26187TH |
Product Overview : | Recombinant fragment: MSDDKPFLCT APGCGQRFTN EDHLAVHKHK HEMTLKFGPA RNDSVIVADQ TPTPTRFLKN CEEVGLFNEL ASPFENEF, corresponding to amino acids 19-96 of Human ATF2 with an N-terminal proprietary tag, MWt 34.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 19-96 a.a. |
Description : | This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. Additional transcript variants have been identified but their biological validity has not been determined. |
Tissue specificity : | Abundant expression seen in the brain. |
Form : | Lyophilised |
Storage buffer : | Preservative: NoneConstituents: 50% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8.0 |
Storage : | Store at -80°C |
Sequences of amino acids : | MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEF |
Sequence Similarities : | Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain.Contains 1 C2H2-type zinc finger. |
Gene Name | ATF2 activating transcription factor 2 [ Homo sapiens ] |
Official Symbol | ATF2 |
Synonyms | ATF2; activating transcription factor 2; cAMP responsive element binding protein 2 , CREB2; cyclic AMP-dependent transcription factor ATF-2; CRE BP1; HB16; TREB7; |
Gene ID | 1386 |
mRNA Refseq | NM_001880 |
Protein Refseq | NP_001871 |
MIM | 123811 |
Uniprot ID | P15336 |
Chromosome Location | 2q32 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; chromatin binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
ATF2-2659H | Recombinant Human ATF2 protein(351-440 aa), C-His-tagged | +Inquiry |
ATF2-494R | Recombinant Rat ATF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF2-1432H | Recombinant Human Activating Transcription Factor 2, GST-tagged | +Inquiry |
ATF2-2562H | Recombinant Human ATF2 protein, His-SUMO-tagged | +Inquiry |
ATF2-692H | Active Recombinant Human ATF2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF2-518HCL | Recombinant Human ATF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATF2 Products
Required fields are marked with *
My Review for All ATF2 Products
Required fields are marked with *
0
Inquiry Basket