"ATOX1" Related Products

Expand
Expand
Expand

Recombinant Human ATOX1, His-tagged

Cat.No.: ATOX1-26191TH
Product Overview: Recombinant full length Human ATOX1 with N terminal His tag; 88 amino acids with a predicted MWt 9.5kDa including tag.
Description: This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Protein length: 68 amino acids
Conjugation: HIS
Molecular Weight: 9.500kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.24% Tris, 0.02% DTT, 10% Glycerol
Storage: Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Sequence Similarities: Belongs to the ATX1 family.Contains 1 HMA domain.
Gene Name: ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
Official Symbol: ATOX1
Synonyms: ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1;
Gene ID: 475
mRNA Refseq: NM_004045
Protein Refseq: NP_004036
MIM: 602270
Uniprot ID: O00244
Chromosome Location: 5q32
Pathway: Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function: copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.