Recombinant Human ATOX1

Cat.No. : ATOX1-26679TH
Product Overview : Recombinant Full Length Human ATOX1 produced in Saccharomyces cerevisiae; amino acids 1-68 with 26 kDa tag. Molecular weight with tag is 34 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-68 a.a.
Description : This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKV CIESEHSMDTLLATLKKTGKTVSYLGLE
Sequence Similarities : Belongs to the ATX1 family.Contains 1 HMA domain.
Full Length : Full L.
Gene Name ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ]
Official Symbol ATOX1
Synonyms ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1;
Gene ID 475
mRNA Refseq NM_004045
Protein Refseq NP_004036
MIM 602270
Uniprot ID O00244
Chromosome Location 5q32
Pathway Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATOX1 Products

Required fields are marked with *

My Review for All ATOX1 Products

Required fields are marked with *

0
cart-icon