Recombinant Human ATOX1
Cat.No. : | ATOX1-26679TH |
Product Overview : | Recombinant Full Length Human ATOX1 produced in Saccharomyces cerevisiae; amino acids 1-68 with 26 kDa tag. Molecular weight with tag is 34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-68 a.a. |
Description : | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKV CIESEHSMDTLLATLKKTGKTVSYLGLE |
Sequence Similarities : | Belongs to the ATX1 family.Contains 1 HMA domain. |
Full Length : | Full L. |
Gene Name | ATOX1 ATX1 antioxidant protein 1 homolog (yeast) [ Homo sapiens ] |
Official Symbol | ATOX1 |
Synonyms | ATOX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 (antioxidant protein 1, yeast) homolog 1; copper transport protein ATOX1; HAH1; |
Gene ID | 475 |
mRNA Refseq | NM_004045 |
Protein Refseq | NP_004036 |
MIM | 602270 |
Uniprot ID | O00244 |
Chromosome Location | 5q32 |
Pathway | Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
Function | copper chaperone activity; copper ion binding; copper-dependent protein binding; metal ion binding; metallochaperone activity; |
◆ Recombinant Proteins | ||
ATOX1-26191TH | Recombinant Human ATOX1, His-tagged | +Inquiry |
ATOX1-6909H | Recombinant Human ATX1 Antioxidant Protein 1 Homolog (yeast), His-tagged | +Inquiry |
ATOX1-8172Z | Recombinant Zebrafish ATOX1 | +Inquiry |
ATOX1-452H | Recombinant Human ATX1 Antioxidant Protein 1 Homolog (Yeast) | +Inquiry |
ATOX1-5084C | Recombinant Chicken ATOX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOX1-8616HCL | Recombinant Human ATOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATOX1 Products
Required fields are marked with *
My Review for All ATOX1 Products
Required fields are marked with *
0
Inquiry Basket