"ATP5O" Related Products

Expand
Expand

Recombinant Human ATP5O, His-tagged

Cat.No.: ATP5O-27062TH
Product Overview: Recombinant full length Human ATP5O with an N terminal His tag; 211 amino acids with tag, Predicted MWt 23.1 kDa.
Description: The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
Protein length: 190 amino acids
Conjugation: HIS
Molecular Weight: 23.100kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Sequence Similarities: Belongs to the ATPase delta chain family.
Gene Name: ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ]
Official Symbol: ATP5O
Synonyms: ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP;
Gene ID: 539
mRNA Refseq: NM_001697
Protein Refseq: NP_001688
MIM: 600828
Uniprot ID: P48047
Chromosome Location: 21q22
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem;
Function: contributes_to ATPase activity; drug binding; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein complex binding; steroid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.