"BCKDHA" Related Products

Expand

Recombinant Human BCKDHA, His-tagged

Cat.No.: BCKDHA-27439TH
Product Overview: Recombinant fragment, corresponding to amino acids 51-445 of Human BCKDHA with N terminal His tag; Predicted MWt 46 kDa.
Description: The branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 69 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIIN PSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRI SFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMY RDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVT ISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEG DAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGD GIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAE NQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQD HPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAE RKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGE HYPLDHFDK
Sequence Similarities: Belongs to the BCKDHA family.
Gene Name: BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide [ Homo sapiens ]
Official Symbol: BCKDHA
Synonyms: BCKDHA; branched chain keto acid dehydrogenase E1, alpha polypeptide; 2 oxoisovalerate dehydrogenase (lipoamide) , branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease) , OVD1A; 2-oxoisovalerate dehydrogenase subunit al
Gene ID: 593
mRNA Refseq: NM_000709
Protein Refseq: NP_000700
MIM: 608348
Uniprot ID: P12694
Chromosome Location: 19q13.1-q13.2
Pathway: 2-oxobutanoate degradation I, conserved biosystem; Branched-chain amino acid catabolism, organism-specific biosystem; Leucine degradation, leucine => acetoacetate + acetyl-CoA, organism-specific biosystem; Leucine degradation, leucine =>
Function: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity; alpha-ketoacid dehydrogenase activity; carboxy-lyase activity; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.