Recombinant Human BCKDHA protein, His-tagged
| Cat.No. : | BCKDHA-19H |
| Product Overview : | Recombinant Human BCKDHA protein(264-445 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 264-445 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK |
| Gene Name | BCKDHA branched chain keto acid dehydrogenase E1, alpha polypeptide [ Homo sapiens ] |
| Official Symbol | BCKDHA |
| Synonyms | BCKDHA; branched chain keto acid dehydrogenase E1, alpha polypeptide; 2 oxoisovalerate dehydrogenase (lipoamide) , branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease) , OVD1A; 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; maple syrup urine disease; MSU; BCKDH E1-alpha; 2-oxoisovalerate dehydrogenase (lipoamide); branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; MSUD1; OVD1A; BCKDE1A; FLJ45695; |
| Gene ID | 593 |
| mRNA Refseq | NM_000709 |
| Protein Refseq | NP_000700 |
| MIM | 608348 |
| UniProt ID | P12694 |
| ◆ Recombinant Proteins | ||
| BCKDHA-338C | Recombinant Cynomolgus BCKDHA Protein, His-tagged | +Inquiry |
| BCKDHA-1630HF | Recombinant Full Length Human BCKDHA Protein, GST-tagged | +Inquiry |
| BCKDHA-27442TH | Recombinant Human BCKDHA, His-tagged | +Inquiry |
| BCKDHA-86C | Recombinant Cynomolgus Monkey BCKDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCKDHA-136H | Recombinant Human BCKDHA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCKDHA-163HCL | Recombinant Human BCKDHA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCKDHA Products
Required fields are marked with *
My Review for All BCKDHA Products
Required fields are marked with *
