"BCL11B" Related Products

Recombinant Human BCL11B, His-tagged

Cat.No.: BCL11B-28027TH
Product Overview: Recombinant fragment, corresponding to amino acids 387-823 of Human Ctip2 with an N-terminal His Tag, approximately 58kDa
Description: This gene encodes a C2H2-type zinc finger protein and is closely related to BCL11A, a gene whose translocation may be associated with B-cell malignancies. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 138 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QLCDHACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASS PEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDE EEEEEEEELLLENESRPESSFSMDSELSRNRENGGGGV PGVPGAGGGAAKALADEKALVLGKVMENVGLGALPQYGEL LADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGAV NGRGGGFAPGTEPFPGLFPRKPAPLPSPGLNSAAKRIK VEKDLELPPAALIPSENVYSQWLVGYAASRHFMKDPFLGF TDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGR SGTASGGSTPHLGGPGPGRPSSKEGRRSDTCEYCGKVF KNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKT HGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLT NDVKIEQAERS
Gene Name: BCL11B B-cell CLL/lymphoma 11B (zinc finger protein) [ Homo sapiens ]
Official Symbol: BCL11B
Synonyms: BCL11B; B-cell CLL/lymphoma 11B (zinc finger protein); ZNF856B; B-cell lymphoma/leukemia 11B; CTIP 2; CTIP2; hRIT1 alpha;
Gene ID: 64919
mRNA Refseq: NM_022898
Protein Refseq: NP_075049
MIM: 606558
Uniprot ID: Q9C0K0
Chromosome Location: 14q32
Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.