Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human BCS1L, His-tagged

Cat.No. : BCS1L-26667TH
Product Overview : Recombinant fragment, corresponding to amino acids 236-418 of Human BCS1L with N terminal His tag; 183 amino acids, 21kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 71 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQ QSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLL NALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYV GYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQI SPAQVQGYFMLYKNDPVGAIHNAESLR
Gene Name : BCS1L BCS1-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol : BCS1L
Synonyms : BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like , BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719;
Gene ID : 617
mRNA Refseq : NM_001079866
Protein Refseq : NP_001073335
MIM : 603647
Uniprot ID : Q9Y276
Chromosome Location : 2q35
Function : ATP binding; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All BCS1L Products

Required fields are marked with *

My Review for All BCS1L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends