"BCS1L" Related Products

Expand
Expand
Expand

Recombinant Human BCS1L, His-tagged

Cat.No.: BCS1L-26667TH
Product Overview: Recombinant fragment, corresponding to amino acids 236-418 of Human BCS1L with N terminal His tag; 183 amino acids, 21kDa.
Description: This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 71 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQ QSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLL NALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYV GYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQI SPAQVQGYFMLYKNDPVGAIHNAESLR
Gene Name: BCS1L BCS1-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol: BCS1L
Synonyms: BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like , BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719;
Gene ID: 617
mRNA Refseq: NM_001079866
Protein Refseq: NP_001073335
MIM: 603647
Uniprot ID: Q9Y276
Chromosome Location: 2q35
Function: ATP binding; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.