"BLMH" Related Products

Expand
Expand

Recombinant Human BLMH, His-tagged

Cat.No.: BLMH-26116TH
Product Overview: Recombinant fragment, corresponding to amino acids 309-455 of Human BLMH with N terminal His tag; 147 amino acids, 20kDa.
Description: Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHEL VFGVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQD GAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVV DRKHVPEEVLAVLEQEPIILPAWDPMGALAE
Gene Name: BLMH bleomycin hydrolase [ Homo sapiens ]
Official Symbol: BLMH
Synonyms: BLMH; bleomycin hydrolase; BH;
Gene ID: 642
mRNA Refseq: NM_000386
Protein Refseq: NP_000377
MIM: 602403
Uniprot ID: Q13867
Chromosome Location: 17q11.2
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: aminopeptidase activity; carboxypeptidase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.