Recombinant Human BLMH, His-tagged

• Cat.No.: BLMH-26116TH
• Product Overview: Recombinant fragment, corresponding to amino acids 309-455 of Human BLMH with N terminal His tag; 147 amino acids, 20kDa.

Specification

• Description: Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 98 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHEL VFGVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQD GAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVV DRKHVPEEVLAVLEQEPIILPAWDPMGALAE

Gene Information

• Gene Name: BLMH bleomycin hydrolase [ Homo sapiens ]
• Official Symbol: BLMH
• Synonyms: BLMH; bleomycin hydrolase; BH
• Gene ID: 642
• mRNA Refseq: NM_000386
• Protein Refseq: NP_000377
• MIM: 602403
• Uniprot ID: Q13867
• Chromosome Location: 17q11.2
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: aminopeptidase activity; carboxypeptidase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity