Recombinant Human BLMH, His-tagged
Cat.No. : | BLMH-26116TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 309-455 of Human BLMH with N terminal His tag; 147 amino acids, 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 309-455 a.a. |
Description : | Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHEL VFGVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQD GAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVV DRKHVPEEVLAVLEQEPIILPAWDPMGALAE |
Gene Name | BLMH bleomycin hydrolase [ Homo sapiens ] |
Official Symbol | BLMH |
Synonyms | BLMH; bleomycin hydrolase; BH; |
Gene ID | 642 |
mRNA Refseq | NM_000386 |
Protein Refseq | NP_000377 |
MIM | 602403 |
Uniprot ID | Q13867 |
Chromosome Location | 17q11.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | aminopeptidase activity; carboxypeptidase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
BLMH-802H | Recombinant Human Bleomycin Hydrolase, His-tagged | +Inquiry |
Blmh-420R | Recombinant Rat Blmh Protein, His-tagged | +Inquiry |
BLMH-242H | Recombinant Human BLMH Protein, GST-tagged | +Inquiry |
Blmh-1190M | Recombinant Mouse BLMH protein(Asn2-Glu455), His-tagged | +Inquiry |
BLMH-2416M | Recombinant Mouse BLMH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLMH Products
Required fields are marked with *
My Review for All BLMH Products
Required fields are marked with *