Recombinant Human BLMH, His-tagged
Cat.No. : | BLMH-26116TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 309-455 of Human BLMH with N terminal His tag; 147 amino acids, 20kDa. |
- Specification
- Gene Information
- Related Products
Description : | Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHEL VFGVSLKNMNKAERLTFGESLMTHAMTFTAVSEKDDQD GAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVV DRKHVPEEVLAVLEQEPIILPAWDPMGALAE |
Gene Name : | BLMH bleomycin hydrolase [ Homo sapiens ] |
Official Symbol : | BLMH |
Synonyms : | BLMH; bleomycin hydrolase; BH; |
Gene ID : | 642 |
mRNA Refseq : | NM_000386 |
Protein Refseq : | NP_000377 |
MIM : | 602403 |
Uniprot ID : | Q13867 |
Chromosome Location : | 17q11.2 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function : | aminopeptidase activity; carboxypeptidase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
Products Types
◆ Recombinant Protein | ||
BLMH-418H | Recombinant Human BLMH Protein, His-tagged | +Inquiry |
BLMH-1041M | Recombinant Mouse BLMH Protein, His (Fc)-Avi-tagged | +Inquiry |
Blmh-420R | Recombinant Rat Blmh Protein, His-tagged | +Inquiry |
Blmh-419M | Recombinant Mouse Blmh Protein, His-tagged | +Inquiry |
Blmh-1190M | Recombinant Mouse Blmh, His tagged | +Inquiry |
◆ Lysates | ||
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket