Recombinant Human BUB1B
| Cat.No. : | BUB1B-26124TH |
| Product Overview : | Recombinant fragment of Human BubR1 with a N terminal proprietary tag; predicted molecular weight 39.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 130 amino acids |
| Description : | This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. |
| Molecular Weight : | 39.930kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMST LQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDR YISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR FLNLWLKLGR |
| Gene Name | BUB1B budding uninhibited by benzimidazoles 1 homolog beta (yeast) [ Homo sapiens ] |
| Official Symbol | BUB1B |
| Synonyms | BUB1B; budding uninhibited; budding uninhibited by benzimidazoles 1 (yeast homolog), beta; mitotic checkpoint serine/threonine-protein kinase BUB1 beta; Bub1A; BUBR1; MAD3L; SSK1; |
| Gene ID | 701 |
| mRNA Refseq | NM_001211 |
| Protein Refseq | NP_001202 |
| MIM | 602860 |
| Uniprot ID | O60566 |
| Chromosome Location | 15q15 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
| Function | ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; |
| ◆ Recombinant Proteins | ||
| BUB1B-10335H | Recombinant Human BUB1B, GST-tagged | +Inquiry |
| BUB1B-5973C | Recombinant Chicken BUB1B | +Inquiry |
| BUB1B-26124TH | Recombinant Human BUB1B | +Inquiry |
| Bub1b-726M | Recombinant Mouse Bub1b Protein, MYC/DDK-tagged | +Inquiry |
| BUB1B-4915HF | Active Recombinant Full Length Human BUB1B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BUB1B-076HKCL | Human BUB1B Knockdown Cell Lysate | +Inquiry |
| BUB1B-8382HCL | Recombinant Human BUB1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BUB1B Products
Required fields are marked with *
My Review for All BUB1B Products
Required fields are marked with *
