Recombinant Human C9, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human C9, GST-tagged

Recombinant Human C9, GST-tagged

C9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : C9-26247TH
Product Overview : Recombinant Human C9 full-length ORF (22 a.a. - 559 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes the final component of the complement system. It participates in the formation of the Membrane Attack Complex (MAC).The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component C9 deficiency.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 84.92 kDa
AA Sequence : QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCED AEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTP FDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPT ETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISV GAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQ KLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKI SEGLPALEFPNEK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : C9 complement component 9 [ Homo sapiens ]
Official Symbol : C9
Synonyms : C9D; ARMD15; complement component C9
Gene ID : 735
mRNA Refseq : NM_001737
Protein Refseq : NP_001728
MIM : 120940
UniProt ID : P02748
Chromosome Location : 5p14-p12
Pathway : Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Complement Activation, Classical Pathway, organism-specific biosystem

Products Types

◆ Recombinant Protein

C9-0175HRecombinant Human C9 Protein, GST-Tagged+Inquiry
C9-2593MRecombinant Mouse C9 Protein+Inquiry
C9-1056RRecombinant Rat C9 Protein+Inquiry
C9-1845RRecombinant Rabbit C9 protein, His & T7-tagged+Inquiry
C9-1844MRecombinant Mouse C9 protein, His-tagged+Inquiry

See All C9 Recombinant Protein

◆ Native Protein

C9-58HNative Human Complement C9+Inquiry

See All C9 Native Protein

◆ Lysates

C9-7945HCLRecombinant Human C9 293 Cell Lysate+Inquiry

See All C9 Lysates

Related Gene

C12orf5C19orf10C1QBC1QBPC1QL2C1QTNF1C1QTNF2C1QTNF5C1QTNF6C1QTNF7C1qtnf9C1sC2C4orf7C5C6orf108C11orf30C13orf1C17orf75C1DC1GALT1C1orf38C1QCC20orf30C21orf33C3C4BC5orf32C6orf115C9orf86C9orf96C8BC18orf1C1QAC17orf28C21orf59C20orf43C10orf82C15orf40C16orf72C1orf50C2orf40C9orf41C1QTNF3C1QTNF8C5AR1C10orf2C13orf15C15orf15C15orf29C20orf7C2orf28C3orf10C4AC4BPAC4BPBC4orf6C6C7orf10C7orf16C7orf38C9C9orf95C20orf20C14orf129C16orf53C10orf81C11orf17C12orf24C13orf31C14orf126C16orf35C17orf37C17orf88C18orf23C19orf50C1orf163C1orf57C1orf67C1orf89C21orf2C2orf62C4orf43C6orf199C9orf103C9orf98CC14ORF169C3AR1C14ORF166C19ORF2C19ORF43C1RC20ORF3C7C8AC8GC8orf44-SGK3C14ORF159C10ORF67C16ORF58C21ORF63C10ORF57C10ORF62C11ORF24C11ORF46C3ORF64C10ORF137C13ORF33C10ORF129C11ORF2C8ORF33C7ORF42C6ORF118C7ORF58C14ORF180C14ORF21C14ORF28C14ORF37C1ORF96C12ORF49C12ORF50C12ORF53C9ORF100C9ORF114C13ORF26C13ORF30C11ORF21C9ORF64C9ORF68C10ORF116C21ORF7C14ORF133C14ORF135C17ORF48C17ORF49C17ORF53C11ORF53C11ORF54C5ORF24C5ORF35C5ORF4C5ORF51C17ORF56C17ORF57C1ORF110C1ORF111C1ORF122C1ORF127C1ORF129C7ORF43C7ORF44C7ORF50C16ORF61C16ORF62C16ORF70C16ORF71C16ORF73C16ORF78C16ORF87C17ORF104C17ORF39C17ORF42C14ORF177C14ORF80C15ORF27C15ORF32C15ORF33C15ORF38C15ORF39C15ORF17C15ORF24C15ORF26C15ORF41C15ORF44C15ORF52C15ORF62C16ORF13C16ORF45C16ORF46C16ORF48C16ORF5C16ORF57C1ORF94C1ORF95C21ORF91C22ORF13C22ORF25C22ORF36C2CD2C2CD4CC2ORF18C9ORF89C9ORF153C9ORF156C20ORF72C20ORF79C10ORF93C10ORF95C11ORF16C9ORF78C3ORF62C3ORF67C3ORF70C3ORF75C6ORF201C6ORF223C6ORF25C21ORF56C3ORF15C3ORF17C3ORF18C6ORF1C6ORF10C2ORF89C10ORF88C1ORF87C1ORF93C14ORF105C11ORF73C11ORF74C11ORF85C11ORF87C1ORF84C1QL1C1QL3C20ORF132C20ORF134C20ORF141C20ORF144C5ORF20C20ORF194C20ORF195C20ORF196C20ORF24C20ORF4C21ORF58C21ORF62C2ORF27AC2ORF29C2ORF3C2ORF42C2ORF43C2ORF47C2ORF50C2ORF53C2ORF55C2ORF56C2ORF57C2ORF68C2ORF69C2ORF80C10ORF140C10ORF46C10ORF47C11ORF57C11ORF63C11ORF65C11ORF67C11ORF71C12ORF11C12ORF29C12ORF4C12ORF40C12ORF42C12ORF48C19ORF55C19ORF56C19ORF73C1GALT1C1C12ORF54C12ORF61C12ORF63C12ORF66C12ORF68C14ORF118C18ORF8C19ORF18C19ORF21C19ORF24C19ORF28C19ORF45C19ORF46C19ORF47C19ORF52C19ORF54C17ORF59C17ORF64C17ORF66C17ORF74C17ORF77C17ORF78C17ORF80C17ORF81C20ORF107C20ORF11C20ORF111C20ORF112C1ORF65C6ORF58C6ORF62C7ORF61C7ORF62C7ORF64C9ORF117C9ORF123C17ORF82C17ORF97C18ORF10C18ORF25C18ORF34C18ORF54C18ORF56C1ORF100C1ORF131C1ORF141C1ORF144C1ORF159C1ORF172C1ORF177C1ORF182C1ORF183C1ORF186C1ORF187C1ORF190C7ORF23C1ORF216C1ORF31C1ORF43C1ORF51C1ORF52C1ORF53C1ORF54C1ORF55C1ORF56C1ORF74C1RLC20ORF160C20ORF165C20ORF173C20ORF177C3ORF23C3ORF24C3ORF33C3ORF37C3ORF38C3ORF39C3ORF58C4ORF19C4ORF22C4ORF27C4ORF32C4ORF33C4ORF36C4ORF44C4ORF45C4ORF46C4ORF47C6ORF64C6ORF70C6ORF81C6ORF97C7ORF29C8ORF34C8ORF45C8ORF48C8ORF59C5ORF54C5ORF55C5ORF60C6ORF120C6ORF127C6ORF146C6ORF174C6ORF192C8ORF76C8ORF84C9ORF174C9ORF25C9ORF3C9ORF30C9ORF4C9ORF40C9ORF43C9ORF46C7ORF31C9ORF128C9ORF150C9ORF152C9ORF167C9ORF170C19ORF29C11ORF68C9ORF9C9ORF82C20ORF54C1QTNF4C6ORF94C10ORF28C14ORF1C19ORF40C5ORF64C2CD4BC2ORF63C17ORF70C10ORF54C19ORF38C22ORF31C19ORF33C19ORF6C5ORF41C20ORF201C20ORF203C5ORF39C10ORF96C7ORF49C1ORF35C4ORF49C14ORF49C1ORF63C12ORF75C5ORF13C9ORF102C10ORF27C22ORF42C13ORF27C11ORF58C1ORF116C2ORF51C2CD2LC7ORF11C3ORF52C11H16ORF80C1rbC. albicansC15orf55C8orf86C1orf229C20orf78C17orf105C17orf108C9orf172C1orf228C10orf107C14orf2C14orf166BC19orf44C19orf57C19orf59C19orf60C19orf66C19orf70C20orf26C10orf111C10orf113C10orf118C10orf12C10orf120C10orf128C10orf32C10orf35C10orf53C10orf55C10orf68C10orf71C10orf90C10orf91C11orf1C11orf10C11orf34C11orf45C11orf48C11orf49C11orf52C11orf70C11orf80C11orf84C11orf86C11orf9C12orf23C12orf39C12orf43C12orf45C12orf52C12orf60C12orf70C12orf71C12orf73C14orf101C14orf43C14orf45C14orf93C15orf23C15orf43C15orf53C15orf57C15orf59C16orf79C16orf80C16orf88C17orf47C17orf58C17orf67C17orf99C18orf26C18orf32C18orf62C19orf26C19orf42C1orf105C1orf106C1orf109C1orf112C1orf114C1orf123C1orf158C1orf162C1orf168C1orf173C1orf174C1orf192C1orf194C1orf198C1orf21C1orf27C1orf61C1orf64C1orf68C1orf85C1orf86C20orf151C20orf152C20orf166C22orf15C22orf23C22orf28C22orf29C22orf32C2CD3C2orf44C2orf65C2orf66C2orf72C2orf76C2orf83C3orf20C3orf26C4orf21C4orf3C4orf40C5orf15C5orf22C5orf34C5orf44C5orf48C6orf106C6orf130C6orf132C6orf15C6orf162C6orf163C6orf165C6orf195C6orf222C6orf225C6orf57C6orf89C8orf58C8orf74C9orf11C9orf116C9orf131C9orf135C9orf139C7orf25C7orf34C7orf41C7orf45C7orf53C7orf57C7orf59C7orf60C8orf40C8orf4C8orf42C8orf44C8orf47C9orf16C9orf163C9orf169C9orf37C9orf57C9orf50C9orf66C9orf84C9orf91C19ORF76C8orf85C15ORF38-AP3S2C1orf115C1ORF233C10orf11C11orf20C11orf35C11orf40C11orf83C11orf88C11ORF93C11ORF94C11ORF95C13orf35C14orf178C16orf55C17orf100C17orf102C17ORF107C17orf79C17orf96C19orf69C2orf27BC2orf48C2orf88C2ORF91C22orf24C22orf26C4orf17C5ORF63C6ORF228C6orf47C6orf52C7orf26C8orf37C8orf82C8ORF87C1QL4C19orf63C87977C030019I05RikC530028O21RikC330019G07RikC5ORF65C030006K11RikC030030A07RikC030039L03RikC030046E11RikC030046I01RikC030048B08RikC330005M16RikC330006K01RikC330007P06RikC330018D20RikC330021F23RikC330027C09RikC530008M17RikC630004H02RikC5ORF62C17ORF109C17ORF110C15orf42C3orf71C1QTNF9BC2cd4aC2cd4dC1orf101C1orf146C1orf185C1orf189C1orf204C1orf210C1orf212C1orf226C1orf227C1H6orf35C10orf105C10orf131C10orf76C11orf31C11orf91C11orf96C12orf44C12orf56C12orf57C12orf76C14orf142C14orf182C14orf79C15orf56C15orf60C15orf61C16orf3C16orf52C16orf59C16orf82C16orf86C16orf89C16orf90C16orf91C16orf92C16orf93C16orf95C17orf72C17orf89C18orf42C18orf63C19orf48C19orf71C19orf77C2orf15C2orf49C2orf54C2orf61C2orf70C2orf73C2orf74C2orf78C2orf81C2orf82C20orf118C20orf85C22orf46C3orf14C3orf22C3orf35C3orf43C3orf45C3orf79C3orf80C4orf29C4orf34C4orf48C4orf51C4orf52C5orf30C5orf38C5orf42C5orf45C5orf47C5orf52C5orf58C6orf136C6orf141C6orf170C6orf203C6orf211C6orf226C6orf48C6orf99C7orf33C7orf63C7orf65C7orf66C7orf71C7orf73C8orf46C8orf73C9orf129C9orf142C9orf171C9orf24C9orf47C9orf85C130022K22RikC3orf19C14orf38C1raC4bpC77080C77370C78339C80913C86695C87414C87436C130026I21RikC130039O16RikC130050O18RikC130060K24RikC130074G19RikC130079G13RikC230052I12RikC230081A13RikC20orf94C3orf78C3orf77C14orf176C16orf7C2orf39C11orf42C12orf65C15orf48C19orf80C11H2orf49

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.