Recombinant Human CABP7, His-tagged
Cat.No. : | CABP7-27794TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-188 of Human Calcium binding protein 7 with N terminal His tag; 208 amino acids with tag, MWt 23.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 188 amino acids |
Description : | CABP7, also known as Calcium-binding protein 7, contains two EF-hand domains. It negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity. |
Conjugation : | HIS |
Molecular Weight : | 23.700kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS, pH 7.4 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKS |
Sequence Similarities : | Contains 2 EF-hand domains. |
Gene Name | CABP7 calcium binding protein 7 [ Homo sapiens ] |
Official Symbol | CABP7 |
Synonyms | CABP7; calcium binding protein 7; calcium-binding protein 7; MGC57793; |
Gene ID | 164633 |
mRNA Refseq | NM_182527 |
Protein Refseq | NP_872333 |
Uniprot ID | Q86V35 |
Chromosome Location | 22q12.2 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CABP7-723R | Recombinant Rat CABP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CABP7-27794TH | Recombinant Human CABP7, His-tagged | +Inquiry |
CABP7-1063H | Recombinant Human CABP7 protein, GST-tagged | +Inquiry |
CABP7-0261H | Recombinant Human CABP7 Protein, GST-Tagged | +Inquiry |
CABP7-3180H | Recombinant Human CABP7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABP7-7907HCL | Recombinant Human CABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABP7 Products
Required fields are marked with *
My Review for All CABP7 Products
Required fields are marked with *