Recombinant Human CABP7, His-tagged

• Cat.No.: CABP7-27794TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-188 of Human Calcium binding protein 7 with N terminal His tag; 208 amino acids with tag, MWt 23.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 188 amino acids
• Description: CABP7, also known as Calcium-binding protein 7, contains two EF-hand domains. It negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity.
• Conjugation: HIS
• Molecular Weight: 23.700kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: PBS, pH 7.4
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKS
• Sequence Similarities: Contains 2 EF-hand domains.

Gene Information

• Gene Name: CABP7 calcium binding protein 7 [ Homo sapiens ]
• Official Symbol: CABP7
• Synonyms: CABP7; calcium binding protein 7; calcium-binding protein 7; MGC57793
• Gene ID: 164633
• mRNA Refseq: NM_182527
• Protein Refseq: NP_872333
• Uniprot ID: Q86V35
• Chromosome Location: 22q12.2
• Function: calcium ion binding