Recombinant Human CACNB1, His-tagged
| Cat.No. : | CACNB1-26767TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 395-598 a.a. |
| Description : | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
| Conjugation : | HIS |
| Tissue specificity : | Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle. |
| Form : | Lyophilised:Reconstitute with 62 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR |
| Sequence Similarities : | Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain. |
| Gene Name | CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ] |
| Official Symbol | CACNB1 |
| Synonyms | CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1; |
| Gene ID | 782 |
| mRNA Refseq | NM_000723 |
| Protein Refseq | NP_000714 |
| MIM | 114207 |
| Uniprot ID | Q02641 |
| Chromosome Location | 17q21-q22 |
| Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; |
| Function | high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNB1 Products
Required fields are marked with *
My Review for All CACNB1 Products
Required fields are marked with *




