Recombinant Human CACNB1, His-tagged

• Cat.No.: CACNB1-26767TH
• Product Overview: Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa.

Specification

• Description: The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
• Form: Lyophilised:Reconstitute with 62 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR
• Sequence Similarities: Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.

Gene Information

• Gene Name: CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ]
• Official Symbol: CACNB1
• Synonyms: CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1
• Gene ID: 782
• mRNA Refseq: NM_000723
• Protein Refseq: NP_000714
• MIM: 114207
• Uniprot ID: Q02641
• Chromosome Location: 17q21-q22
• Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem
• Function: high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity