"CACYBP" Related Products

Expand
Expand
Expand

Recombinant Human CACYBP, His-tagged

Cat.No.: CACYBP-29815TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa.
Description: The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 100 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
Gene Name: CACYBP calcyclin binding protein [ Homo sapiens ]
Official Symbol: CACYBP
Synonyms: CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP;
Gene ID: 27101
mRNA Refseq: NM_001007214
Protein Refseq: NP_001007215
MIM: 606186
Uniprot ID: Q9HB71
Chromosome Location: 1q24-q25
Pathway: Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function: protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.