Recombinant Human CACYBP, His-tagged
| Cat.No. : | CACYBP-29815TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-228 a.a. |
| Description : | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 100 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF |
| Full Length : | Full L. |
| Gene Name | CACYBP calcyclin binding protein [ Homo sapiens ] |
| Official Symbol | CACYBP |
| Synonyms | CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP; |
| Gene ID | 27101 |
| mRNA Refseq | NM_001007214 |
| Protein Refseq | NP_001007215 |
| MIM | 606186 |
| Uniprot ID | Q9HB71 |
| Chromosome Location | 1q24-q25 |
| Pathway | Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
| Function | protein binding; protein homodimerization activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACYBP Products
Required fields are marked with *
My Review for All CACYBP Products
Required fields are marked with *




