Recombinant Human CACYBP, His-tagged
Cat.No. : | CACYBP-29815TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 100 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF |
Gene Name : | CACYBP calcyclin binding protein [ Homo sapiens ] |
Official Symbol : | CACYBP |
Synonyms : | CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP; |
Gene ID : | 27101 |
mRNA Refseq : | NM_001007214 |
Protein Refseq : | NP_001007215 |
MIM : | 606186 |
Uniprot ID : | Q9HB71 |
Chromosome Location : | 1q24-q25 |
Pathway : | Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function : | protein binding; protein homodimerization activity; |
Products Types
◆ Recombinant Protein | ||
CACYBP-0281H | Recombinant Human CACYBP Protein, GST-Tagged | +Inquiry |
CACYBP-434R | Recombinant Rhesus Macaque CACYBP Protein, His (Fc)-Avi-tagged | +Inquiry |
CACYBP-743R | Recombinant Rat CACYBP Protein, His (Fc)-Avi-tagged | +Inquiry |
CACYBP-579H | Recombinant Human CACYBP Protein, His-tagged | +Inquiry |
CACYBP-1178M | Recombinant Mouse CACYBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CACYBP-7898HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
CACYBP-7899HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket