"CALCOCO2" Related Products

Expand

Recombinant Human CALCOCO2, His-tagged

Cat.No.: CALCOCO2-27798TH
Product Overview: Recombinant fragment, corresponding to amino acids 191-446 of Human CALCOCO2 with an N terminal His tag. Observed mwt: 34kDa ;
Description: The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain.
Form: Lyophilised:Reconstitute with 95 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRV DQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHL FLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLL SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQ ESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Gene Name: CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens ]
Official Symbol: CALCOCO2
Synonyms: CALCOCO2; calcium binding and coiled-coil domain 2; calcium-binding and coiled-coil domain-containing protein 2; MGC17318; NDP52;
Gene ID: 10241
mRNA Refseq: NM_005831
Protein Refseq: NP_005822
MIM: 604587
Uniprot ID: Q13137
Chromosome Location: 17q21.32
Function: protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.