Recombinant Human CALCOCO2, His-tagged

Cat.No. : CALCOCO2-27798TH
Product Overview : Recombinant fragment, corresponding to amino acids 191-446 of Human CALCOCO2 with an N terminal His tag. Observed mwt: 34kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-446 a.a.
Description : The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles.
Conjugation : HIS
Tissue specificity : Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain.
Form : Lyophilised:Reconstitute with 95 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRV DQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHL FLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLL SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQ ESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Gene Name CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens ]
Official Symbol CALCOCO2
Synonyms CALCOCO2; calcium binding and coiled-coil domain 2; calcium-binding and coiled-coil domain-containing protein 2; MGC17318; NDP52;
Gene ID 10241
mRNA Refseq NM_005831
Protein Refseq NP_005822
MIM 604587
Uniprot ID Q13137
Chromosome Location 17q21.32
Function protein binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALCOCO2 Products

Required fields are marked with *

My Review for All CALCOCO2 Products

Required fields are marked with *

0
cart-icon