Recombinant Human CALCOCO2, His-tagged CALCOCO2-27798TH

Recombinant Human CALCOCO2, His-tagged

PRODUCTS

Home / Products / Recombinant Human CALCOCO2, His-tagged

Recombinant Human CALCOCO2, His-tagged

CALCOCO2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CALCOCO2-27798TH
Product Overview : Recombinant fragment, corresponding to amino acids 191-446 of Human CALCOCO2 with an N terminal His tag. Observed mwt: 34kDa ;
Description : The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain.
Form : Lyophilised:Reconstitute with 95 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRV DQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHL FLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLL SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQ ESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Gene Name : CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens ]
Official Symbol : CALCOCO2
Synonyms : CALCOCO2; calcium binding and coiled-coil domain 2; calcium-binding and coiled-coil domain-containing protein 2; MGC17318; NDP52;
Gene ID : 10241
mRNA Refseq : NM_005831
Protein Refseq : NP_005822
MIM : 604587
Uniprot ID : Q13137
Chromosome Location : 17q21.32
Function : protein binding; protein homodimerization activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy