Recombinant Human CALML3

Cat.No. : CALML3-26630TH
Product Overview : Recombinant full length Human CALML3 with a N terminal proprietary tag; Predicted MWt 42.13 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 149 amino acids
Description : Calmodulin-like protein 3 is a protein that in humans is encoded by the CALML3 gene.
Molecular Weight : 42.130kDa inclusive of tags
Tissue specificity : Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSL GQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDT DNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE EVDEMIRAADTDGDGQVNYEEFVRVLVSK
Sequence Similarities : Belongs to the calmodulin family.Contains 4 EF-hand domains.
Gene Name CALML3 calmodulin-like 3 [ Homo sapiens ]
Official Symbol CALML3
Synonyms CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP;
Gene ID 810
mRNA Refseq NM_005185
Protein Refseq NP_005176
MIM 114184
Uniprot ID P27482
Chromosome Location 10pter-p13
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dopaminergic synapse, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALML3 Products

Required fields are marked with *

My Review for All CALML3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon