Recombinant Human CBR4, His-tagged

Cat.No. : CBR4-26329TH
Product Overview : Recombinant full length Human CBR4 with N terminal His tag; 257 amino acids with tag, Predicted MWt 27.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 237 amino acids
Description : CBR4 belongs to the short-chain dehydrogenase/reductase family. The formation of heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity for o- and p-quinones.
Conjugation : HIS
Molecular Weight : 27.500kDa inclusive of tags
Tissue specificity : Detected in liver and kidney (at protein level).
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEMEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name CBR4 carbonyl reductase 4 [ Homo sapiens ]
Official Symbol CBR4
Synonyms CBR4; carbonyl reductase 4; carbonyl reductase family member 4; FLJ14431; SDR45C1; short chain dehydrogenase/reductase family 45C; member 1;
Gene ID 84869
mRNA Refseq NM_032783
Protein Refseq NP_116172
Uniprot ID Q8N4T8
Chromosome Location 4q32.3
Function NADPH binding; NADPH binding; NADPH dehydrogenase (quinone) activity; NADPH dehydrogenase (quinone) activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBR4 Products

Required fields are marked with *

My Review for All CBR4 Products

Required fields are marked with *

0
cart-icon