Recombinant Human CBR4, His-tagged
Cat.No. : | CBR4-26329TH |
Product Overview : | Recombinant full length Human CBR4 with N terminal His tag; 257 amino acids with tag, Predicted MWt 27.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237 amino acids |
Description : | CBR4 belongs to the short-chain dehydrogenase/reductase family. The formation of heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity for o- and p-quinones. |
Conjugation : | HIS |
Molecular Weight : | 27.500kDa inclusive of tags |
Tissue specificity : | Detected in liver and kidney (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEMEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | CBR4 carbonyl reductase 4 [ Homo sapiens ] |
Official Symbol | CBR4 |
Synonyms | CBR4; carbonyl reductase 4; carbonyl reductase family member 4; FLJ14431; SDR45C1; short chain dehydrogenase/reductase family 45C; member 1; |
Gene ID | 84869 |
mRNA Refseq | NM_032783 |
Protein Refseq | NP_116172 |
Uniprot ID | Q8N4T8 |
Chromosome Location | 4q32.3 |
Function | NADPH binding; NADPH binding; NADPH dehydrogenase (quinone) activity; NADPH dehydrogenase (quinone) activity; nucleotide binding; |
◆ Recombinant Proteins | ||
CBR4-818R | Recombinant Rat CBR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBR4-4724H | Recombinant Human CBR4 protein, GST-tagged | +Inquiry |
CBR4-11683Z | Recombinant Zebrafish CBR4 | +Inquiry |
CBR4-2789M | Recombinant Mouse CBR4 Protein | +Inquiry |
CBR4-0470H | Recombinant Human CBR4 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBR4-289HCL | Recombinant Human CBR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBR4 Products
Required fields are marked with *
My Review for All CBR4 Products
Required fields are marked with *