"CCT4" Related Products

Expand
Expand

Recombinant Human CCT4, His-tagged

Cat.No.: CCT4-27952TH
Product Overview: Recombinant fragment, corresponding to amino acids 266-539 of Human TCP1 delta with a N terminal His tag; predicted MWt 31 kDa:
Description: The chaperonin containing TCP1 (MIM 186980) complex (CCT), also called the TCP1 ring complex, consists of 2 back-to-back rings, each containing 8 unique but homologous subunits, such as CCT4. CCT assists the folding of newly translated polypeptide substrates through multiple rounds of ATP-driven release and rebinding of partially folded intermediate forms. Substrates of CCT include the cytoskeletal proteins actin (see MIM 102560) and tubulin (see MIM 191130), as well as alpha-transducin (MIM 139330) (Won et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 156 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSIL RDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTK PVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCAS PGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRAL IAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAME VIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRK GGISNILEELVVQPLLVSVSALTLATETVRSILKIDDV VNTR
Gene Name: CCT4 chaperonin containing TCP1, subunit 4 (delta) [ Homo sapiens ]
Official Symbol: CCT4
Synonyms: CCT4; chaperonin containing TCP1, subunit 4 (delta); T-complex protein 1 subunit delta; Cctd;
Gene ID: 10575
mRNA Refseq: NM_006430
Protein Refseq: NP_006421
MIM: 605142
Uniprot ID: P50991
Chromosome Location: 2p15
Pathway: Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem;
Function: ATP binding; nucleotide binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.