Recombinant Human CCT4, His-tagged
Cat.No. : | CCT4-27952TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 266-539 of Human TCP1 delta with a N terminal His tag; predicted MWt 31 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 266-539 a.a. |
Description : | The chaperonin containing TCP1 (MIM 186980) complex (CCT), also called the TCP1 ring complex, consists of 2 back-to-back rings, each containing 8 unique but homologous subunits, such as CCT4. CCT assists the folding of newly translated polypeptide substrates through multiple rounds of ATP-driven release and rebinding of partially folded intermediate forms. Substrates of CCT include the cytoskeletal proteins actin (see MIM 102560) and tubulin (see MIM 191130), as well as alpha-transducin (MIM 139330) (Won et al. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 156 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSIL RDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTK PVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCAS PGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRAL IAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAME VIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRK GGISNILEELVVQPLLVSVSALTLATETVRSILKIDDV VNTR |
Gene Name | CCT4 chaperonin containing TCP1, subunit 4 (delta) [ Homo sapiens ] |
Official Symbol | CCT4 |
Synonyms | CCT4; chaperonin containing TCP1, subunit 4 (delta); T-complex protein 1 subunit delta; Cctd; |
Gene ID | 10575 |
mRNA Refseq | NM_006430 |
Protein Refseq | NP_006421 |
MIM | 605142 |
Uniprot ID | P50991 |
Chromosome Location | 2p15 |
Pathway | Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
CCT4-6363H | Recombinant Human CCT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cct4-804M | Recombinant Mouse Cct4 Protein, MYC/DDK-tagged | +Inquiry |
CCT4-27952TH | Recombinant Human CCT4, His-tagged | +Inquiry |
CCT4-3698H | Recombinant Human CCT4 protein, GST-tagged | +Inquiry |
CCT4-3025M | Recombinant Mouse CCT4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT4-7688HCL | Recombinant Human CCT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCT4 Products
Required fields are marked with *
My Review for All CCT4 Products
Required fields are marked with *