"CD1C" Related Products

Expand

Recombinant Human CD1C

Cat.No.: CD1C-26669TH
Product Overview: Recombinant fragment of Human CD1c (amino acids 77-185) with N terminal proprietary tag, 37.62kDa.
Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.
Protein length: 109 amino acids
Molecular Weight: 37.620kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQV KAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCG SLAQSVCHLLNHQYEGVTETVYNLIRSTC
Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name: CD1C CD1c molecule [ Homo sapiens ]
Official Symbol: CD1C
Synonyms: CD1C; CD1c molecule; CD1, CD1c antigen , CD1C antigen, c polypeptide; T-cell surface glycoprotein CD1c;
Gene ID: 911
mRNA Refseq: NM_001765
Protein Refseq: NP_001756
MIM: 188340
Uniprot ID: P29017
Chromosome Location: 1q22-q23
Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: endogenous lipid antigen binding; exogenous lipid antigen binding; glycolipid binding; lipopeptide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.