Recombinant Human CD1C

Cat.No. : CD1C-26669TH
Product Overview : Recombinant fragment of Human CD1c (amino acids 77-185) with N terminal proprietary tag, 37.62kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.
Molecular Weight : 37.620kDa inclusive of tags
Tissue specificity : Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQV KAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCG SLAQSVCHLLNHQYEGVTETVYNLIRSTC
Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name CD1C CD1c molecule [ Homo sapiens ]
Official Symbol CD1C
Synonyms CD1C; CD1c molecule; CD1, CD1c antigen , CD1C antigen, c polypeptide; T-cell surface glycoprotein CD1c;
Gene ID 911
mRNA Refseq NM_001765
Protein Refseq NP_001756
MIM 188340
Uniprot ID P29017
Chromosome Location 1q22-q23
Pathway Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function endogenous lipid antigen binding; exogenous lipid antigen binding; glycolipid binding; lipopeptide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD1C Products

Required fields are marked with *

My Review for All CD1C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon