Recombinant Human CD1C

• Cat.No.: CD1C-26669TH
• Product Overview: Recombinant fragment of Human CD1c (amino acids 77-185) with N terminal proprietary tag, 37.62kDa.

Specification

• Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.
• Protein length: 109 amino acids
• Molecular Weight: 37.620kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQV KAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCG SLAQSVCHLLNHQYEGVTETVYNLIRSTC
• Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.

Gene Information

• Gene Name: CD1C CD1c molecule [ Homo sapiens ]
• Official Symbol: CD1C
• Synonyms: CD1C; CD1c molecule; CD1, CD1c antigen , CD1C antigen, c polypeptide; T-cell surface glycoprotein CD1c
• Gene ID: 911
• mRNA Refseq: NM_001765
• Protein Refseq: NP_001756
• MIM: 188340
• Uniprot ID: P29017
• Chromosome Location: 1q22-q23
• Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
• Function: endogenous lipid antigen binding; exogenous lipid antigen binding; glycolipid binding; lipopeptide binding