Recombinant Human CD1C Protein (18-302 aa), His-tagged
| Cat.No. : | CD1C-2041H |
| Product Overview : | Recombinant Human CD1C Protein (18-302 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 18-302 aa |
| Description : | Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 34.2 kDa |
| AA Sequence : | NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | CD1C CD1c molecule [ Homo sapiens ] |
| Official Symbol | CD1C |
| Synonyms | CD1C; CD1c molecule; R7; CD1; CD1A; BDCA1; |
| Gene ID | 911 |
| mRNA Refseq | NM_001765 |
| Protein Refseq | NP_001756 |
| MIM | 188340 |
| UniProt ID | P29017 |
| ◆ Recombinant Proteins | ||
| CD1C-0736H | Recombinant Human CD1C Protein, GST-Tagged | +Inquiry |
| CD1C-165H | Recombinant Human CD1C Protein, C-His-tagged | +Inquiry |
| CD1c-1456H | Recombinant Human CD1c Protein (Asn18-Met302), His tagged | +Inquiry |
| CD1C-1984H | Recombinant Human CD1C Protein (18-302 aa), His-tagged | +Inquiry |
| CD1C-2041H | Recombinant Human CD1C Protein (18-302 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD1C-7682HCL | Recombinant Human CD1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1C Products
Required fields are marked with *
My Review for All CD1C Products
Required fields are marked with *
