Recombinant Human CD55, His-tagged
Cat.No. : | CD55-26634TH |
Product Overview : | Recombinant fragment: LPPDVPNAQP ALEGRTSFPE DTVITYKCEE SFVKIPGEKD SVICLKGSQW SDIEEFCNR, corresponding to amino acids 38-96 of Human CD55 fused to a His tag at N-terminal end, 11kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-96 a.a. |
Description : | This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Conjugation : | HIS |
Tissue specificity : | Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body flui |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNR |
Sequence Similarities : | Belongs to the receptors of complement activation (RCA) family.Contains 4 Sushi (CCP/SCR) domains. |
Gene Name | CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ] |
Official Symbol | CD55 |
Synonyms | CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; |
Gene ID | 1604 |
mRNA Refseq | NM_000574 |
Protein Refseq | NP_000565 |
MIM | 125240 |
Uniprot ID | P08174 |
Chromosome Location | 1q32 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
Cd55-695M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
CD55-65H | Recombinant Human CD55 protein, His-tagged | +Inquiry |
CD55-694H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
CD55-2223H | Active Recombinant Human CD55 protein, His-tagged | +Inquiry |
CD55-4052H | Recombinant Human CD55 Protein (Met1-Ser353), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD55 Products
Required fields are marked with *
My Review for All CD55 Products
Required fields are marked with *