Recombinant Human CD79A
| Cat.No. : | CD79A-27509TH |
| Product Overview : | Recombinant fragment (amino acids 33-140) of Human CD79a with proprietary 26 kDa tag; 108 amino acids (Predicted MW 12.16 kDa), 37.51 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 108 amino acids |
| Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Molecular Weight : | 37.510kDa inclusive of tags |
| Tissue specificity : | B-cells. |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGT |
| Sequence Similarities : | Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 ITAM domain. |
| Gene Name | CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ] |
| Official Symbol | CD79A |
| Synonyms | CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha) , IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1; |
| Gene ID | 973 |
| mRNA Refseq | NM_001783 |
| Protein Refseq | NP_001774 |
| MIM | 112205 |
| Uniprot ID | P11912 |
| Chromosome Location | 19q13.2 |
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem; |
| Function | transmembrane signaling receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79A Products
Required fields are marked with *
My Review for All CD79A Products
Required fields are marked with *



