Recombinant Human CDA, His-tagged
Cat.No. : | CDA-26955TH |
Product Overview : | Recombinant full length Human CDA with an N terminal His tag; 166aa, 18.3kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 146 amino acids |
Description : | This gene encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias. |
Conjugation : | HIS |
Molecular Weight : | 18.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 20mM Tris HCl, 2mM EDTA, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ |
Gene Name | CDA cytidine deaminase [ Homo sapiens ] |
Official Symbol | CDA |
Synonyms | CDA; cytidine deaminase; CDD; |
Gene ID | 978 |
mRNA Refseq | NM_001785 |
Protein Refseq | NP_001776 |
MIM | 123920 |
Uniprot ID | P32320 |
Chromosome Location | 1p36.2-p35 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | cytidine deaminase activity; cytidine deaminase activity; hydrolase activity; metal ion binding; nucleoside binding; |
◆ Recombinant Proteins | ||
CDA-598H | Recombinant Human CDA Protein, His-tagged | +Inquiry |
CDA-1079H | Recombinant Human CDA Protein (Ala2-Gln146), His tagged | +Inquiry |
CDA-317HCL | Recombinant Human CDA Over-ex<x>pression Lysate | +Inquiry |
CDA-5564H | Recombinant Human CDA protein, His-tagged | +Inquiry |
CDA-0894H | Recombinant Human CDA Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDA Products
Required fields are marked with *
My Review for All CDA Products
Required fields are marked with *