"CDC20" Related Products

Expand

Recombinant Human CDC20

Cat.No.: CDC20-27897TH
Product Overview: Recombinant fragment corresponding to amino acids 1-100 of Human Cdc20 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle.It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
Sequence Similarities: Belongs to the WD repeat CDC20/Fizzy family.Contains 7 WD repeats.
Gene Name: CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: CDC20
Synonyms: CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog) , CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC;
Gene ID: 991
mRNA Refseq: NM_001255
Protein Refseq: NP_001246
MIM: 603618
Uniprot ID: Q12834
Chromosome Location: 1p34.1
Pathway: APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem;
Function: enzyme binding; protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.