Recombinant Human CDC42EP1, His-tagged

Cat.No. : CDC42EP1-26804TH
Product Overview : Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 283-391 a.a.
Description : CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow.
Conjugation : HIS
Tissue specificity : Endothelial and bone marrow stromal cells.
Form : Lyophilised:Reconstitute with 112 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Sequence Similarities : Belongs to the BORG/CEP family.Contains 1 CRIB domain.
Gene Name CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ]
Official Symbol CDC42EP1
Synonyms CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein;
Gene ID 11135
mRNA Refseq NM_152243
Protein Refseq NP_689449
MIM 606084
Uniprot ID Q00587
Chromosome Location 22q13.1
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC42EP1 Products

Required fields are marked with *

My Review for All CDC42EP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon