"CDC42EP1" Related Products

Expand
Expand

Recombinant Human CDC42EP1, His-tagged

Cat.No.: CDC42EP1-26804TH
Product Overview: Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa.
Description: CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow.
Conjugation: HIS
Source: E. coli
Tissue specificity: Endothelial and bone marrow stromal cells.
Form: Lyophilised:Reconstitute with 112 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Sequence Similarities: Belongs to the BORG/CEP family.Contains 1 CRIB domain.
Gene Name: CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ]
Official Symbol: CDC42EP1
Synonyms: CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein;
Gene ID: 11135
mRNA Refseq: NM_152243
Protein Refseq: NP_689449
MIM: 606084
Uniprot ID: Q00587
Chromosome Location: 22q13.1
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.