Recombinant Human CDC42EP1, His-tagged

• Cat.No.: CDC42EP1-26804TH
• Product Overview: Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa.

Specification

• Description: CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Endothelial and bone marrow stromal cells.
• Form: Lyophilised:Reconstitute with 112 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV
• Sequence Similarities: Belongs to the BORG/CEP family.Contains 1 CRIB domain.

Gene Information

• Gene Name: CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ]
• Official Symbol: CDC42EP1
• Synonyms: CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein
• Gene ID: 11135
• mRNA Refseq: NM_152243
• Protein Refseq: NP_689449
• MIM: 606084
• Uniprot ID: Q00587
• Chromosome Location: 22q13.1
• Function: protein binding