"CENPH" Related Products

Expand
Expand

Recombinant Human CENPH, His-tagged

Cat.No.: CENPH-27395TH
Product Overview: Recombinant fragment, corresponding to amino acids 9-247 of Human CENPH with an N-terminal His Tag, approximately 42kDa
Description: Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 102 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRA QTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLE NEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSS VLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQL KQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNL QMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL EKNVDMM
Sequence Similarities: Belongs to the centromere protein H family.
Gene Name: CENPH centromere protein H [ Homo sapiens ]
Official Symbol: CENPH
Synonyms: CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1;
Gene ID: 64946
mRNA Refseq: NM_022909
Protein Refseq: NP_075060
MIM: 605607
Uniprot ID: Q9H3R5
Chromosome Location: 5p15.2
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem;
Function: kinetochore binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.