"CES1" Related Products

Expand
Expand

Recombinant Human CES1

Cat.No.: CES1-29351TH
Product Overview: Recombinant full length Human Liver Carboxylesterase 1 with N terminal proprietary tag; Predicted MWt 87.67 kDa.
Description: This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Protein length: 567 amino acids
Molecular Weight: 87.670kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed predominantly in liver with lower levels in heart and lung.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSL EGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNA TSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAH ENVVVVTIQYRLGTWGFFSTGDEHSRGNWGHLDQVAALRW VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLG TVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP MLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATE KYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAG APTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFL KEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYN QKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ TEHIEL
Sequence Similarities: Belongs to the type-B carboxylesterase/lipase family.
Gene Name: CES1 carboxylesterase 1 [ Homo sapiens ]
Official Symbol: CES1
Synonyms: CES1; carboxylesterase 1; carboxylesterase 1 (monocyte/macrophage serine esterase 1); liver carboxylesterase 1; CEH; CES1A1; CES1A2; CES2; HMSE; HMSE1; human monocyte/macrophage serine esterase 1; SES1;
Gene ID: 1066
mRNA Refseq: NM_001025194
Protein Refseq: NP_001020365
Uniprot ID: P23141
Chromosome Location: 16q22.2
Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Irinotecan Pathway, organism-specific biosystem;
Function: carboxylesterase activity; hydrolase activity; methyl indole-3-acetate esterase activity; methyl jasmonate esterase activity; methyl salicylate esterase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.